PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009800215.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 752aa    MW: 85138.5 Da    PI: 5.8812
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009800215.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS380.32.4e-1163817493374
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     +lL+ cA+av++++ + a++lL+++++ +sp gd mqRla yf+ +L+ar+a+s++++y+al + ++s    +++l+ ++l+  ++P+ k+s + 
  XP_009800215.1 381 TLLILCAQAVAADNRRTANELLKQIRQCCSPMGDGMQRLAYYFADGLEARMAGSGTHIYRALITLPAS---AADVLKGYQLLLAACPFRKISIFF 472
                     689***********************************************************999999...89********************** PP

            GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledle 190
                      N+aI++ +e++++vHiiD++i+ G+QWpa++q L+sRp+gpp+lRiTg++ p +g   + ++eetg+rL+++A++++vpfefn+ +a+++e+++
  XP_009800215.1 473 SNKAIMNLAENASTVHIIDIGIMWGFQWPAIIQRLSSRPGGPPKLRITGIDFPYPGfrPAVRVEETGRRLTNYAKSFNVPFEFNA-IAQKWETIK 566
                     ******************************************************9999***************************.7******** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                     le+L++++gE l+Vn+ ++  +llde+v+++s+rd +L+l+++ +P+v+++   +  +ns+ F +rf eal +ys+lfd+lea++pre +er+ +
  XP_009800215.1 567 LEDLKINNGEILVVNCLYRFRHLLDETVDVNSPRDVFLNLIRKSNPDVFILGIVNGAYNSPFFITRFREALFHYSSLFDMLEANIPREVHERMLI 661
                     *********************************************************************************************** PP

            GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     E+ +lgre++nv+ace aer+er e++++W++r+++aGF+++pl+e+++  a    + ++++ + ++ ++++l++gWk+r  +++S W+
  XP_009800215.1 662 EKNMLGREAKNVIACEAAERIERPESYKQWQDRIMKAGFRQLPLDEEIMRMATERFKVYDKN-FVIDVDNEWLLQGWKGRIGYALSTWK 749
                     ********************************************************999966.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.058353730IPR005202Transcription factor GRAS
PfamPF035148.3E-114381749IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 752 aa     Download sequence    Send to blast
MKIDRGFMGL YEAGSAIKIE DEAQSFLPDP NLINNLRVSD NLVNNNHVDI SPFQSNTLVR  60
STAEEDYDFS DVVLKYINQM LMEEDIEEMS CMFQESAALR VTERSFYEVI GEEYPPPPNL  120
EKLSDLGQNG YNSRERSGFY YSGNDGRDGI LCPNWNLDLG GYDVSQVPRF LDGVALRSTS  180
WSPHSSSSTV PDVLGDSPVS TLRIPDIFCD SESIMQFKKG VEEASKFIPR GNSLFADVRY  240
NVVGGEQNEE RNDALVKVEK YGERQSPERS RGKKNPLQED VVDLTEERNN KQSAVFSEST  300
VRSEMFDRVL LCSAGKNESA LRESWQTIPR RNVLQNGVSK GSNGKKSQGN KQGNKQDVVE  360
LSKNSQAKKQ GGKRDVVDLG TLLILCAQAV AADNRRTANE LLKQIRQCCS PMGDGMQRLA  420
YYFADGLEAR MAGSGTHIYR ALITLPASAA DVLKGYQLLL AACPFRKISI FFSNKAIMNL  480
AENASTVHII DIGIMWGFQW PAIIQRLSSR PGGPPKLRIT GIDFPYPGFR PAVRVEETGR  540
RLTNYAKSFN VPFEFNAIAQ KWETIKLEDL KINNGEILVV NCLYRFRHLL DETVDVNSPR  600
DVFLNLIRKS NPDVFILGIV NGAYNSPFFI TRFREALFHY SSLFDMLEAN IPREVHERML  660
IEKNMLGREA KNVIACEAAE RIERPESYKQ WQDRIMKAGF RQLPLDEEIM RMATERFKVY  720
DKNFVIDVDN EWLLQGWKGR IGYALSTWKS AC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-483837498375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009800217.10.0PREDICTED: scarecrow-like protein 14
RefseqXP_009800215.10.0PREDICTED: scarecrow-like protein 14
RefseqXP_016458640.10.0PREDICTED: scarecrow-like protein 14
RefseqXP_016458639.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLK4C1Y90.0K4C1Y9_SOLLC; Uncharacterized protein
STRINGSolyc05g053090.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14